PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_08869.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 479aa    MW: 53292.5 Da    PI: 6.0781
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_08869.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.31.3e-083193561954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  Rsa1.0_08869.1_g00001.1 319 FEHflHPYPKDSDKIMLARQTGLSRGQVSNWFINARVR 356
                              554459******************************88 PP

2BELL128.91.8e-41177248172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              erqelq+k +kLls+l+eVd+rYkqy++q+q+v+ssF+++ag+g+akpYt+lAl++iSrhFrcL+dai++qi
  Rsa1.0_08869.1_g00001.1 177 ERQELQNKLSKLLSILDEVDRRYKQYYHQMQIVVSSFDVIAGYGAAKPYTALALQTISRHFRCLRDAISGQI 248
                              79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.1E-67117246IPR006563POX domain
PfamPF075262.2E-47124245IPR006563POX domain
PROSITE profilePS5007111.37297360IPR001356Homeobox domain
SMARTSM003891.0E-8300364IPR001356Homeobox domain
CDDcd000865.73E-11300361No hitNo description
SuperFamilySSF466895.13E-17302367IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-27303366IPR009057Homeodomain-like
PfamPF059208.9E-18317356IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MATYYKSNGS SDIYSRPNAS EFVPENAMIY TNPSVSYFPG EANNVSAPKE IQVLSSFFGG  60
GASQVVEIQD SGSWRDQEDN DRTCFPVMMR PTTGQGLSLG LSSQTETSRG GNNEYATQVV  120
SGFHNSKYLK AAQELLDEAV NVKKALKQFQ PEGDKIEEHR EKNLQESSMN PDLPPSERQE  180
LQNKLSKLLS ILDEVDRRYK QYYHQMQIVV SSFDVIAGYG AAKPYTALAL QTISRHFRCL  240
RDAISGQILV IRRSLGGEVD GLGGGGGGVG ISRLRNVDQQ VRQQRALQRL GVMMQPPHAW  300
KPQRGLPDSS VLILRAWLFE HFLHPYPKDS DKIMLARQTG LSRGQVSNWF INARVRLWKP  360
MVEEMYKEEF TDALEENATT LSSVNNRPET TESQEQHQLV SSSSNGGGDD RFMMVTEMTR  420
NGSGGMSLTL GIPDTRGNDV PMSSDSYENS IQGTSFQYLN SGNGQHRLGS AQFLQDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-15306364563Homeobox protein Meis2
3k2a_B4e-15306364563Homeobox protein Meis2
4xrs_A4e-15306363158Homeobox protein Meis1
4xrs_B4e-15306363158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013628973.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_013725816.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9SIW10.0BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLA0A078DKF30.0A0A078DKF3_BRANA; BnaC03g46250D protein
STRINGBra013076.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.10.0BEL1-like homeodomain 7